SKU: 13075763859

GITR/TNFRSF18 Fc Chimera Protein, Human

Sale price$250.65 Regular price$278.50
Save 10%

Pay in installments of $69.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GITR/TNFRSF18 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CD357 antigen, CD357, GITR, GITR D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid induced TNFR related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18 Accession Q9Y5U5 1 Amino Acid Sequence Gln26 Glu161, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms CD357 antigen, CD357, GITR, GITR-D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid-induced TNFR-related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18
Accession Q9Y5U5-1
Amino Acid Sequence

Gln26-Glu161, with C-terminal Human IgG Fc QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 40-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1,Nature Communications volume 12, Article number: 1378 (2021) Cite this article  5809 Accesses  9 Citations  1 Altmetric  Metrics.

Background

GITR(Glucocorticoid-induced Tumor necrosis factor Receptor), also known as AITR and TNFRSF18, is a 40 kDa transmembrane glycoprotein belonging to the tumor necrosis factor receptor (TNF-R) superfamily. Mature human GITR consists of a 137 amino acid (aa) extracellular domain (ECD) with three tandem TNFR cysteine-rich repeats, a 21 aa transmembrane segment, and a 58 aa cytoplasmic domain. GITR is expressed on CD4+CD25+ regulatory T cells (Treg) as well as on subsets of thymocytes, lymph node cells, and splenocytes. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13075763859

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Christine
Fort Morgan, US
★★★★★ 5
Color was great
Color: Tan, Size: 9 Foot
Perfect patio umbrella, price was fantastic.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
A
Amanda M. Miller
Waukegan, US
★★★★★ 5
Easy to use
Color: Navy, Size: 10 Foot, Color: Navy, Size: 10 Foot
Easy setup and easy use, cranks open very smoothly with no trouble. The fabric is opaque (not light filtering) and sturdy with edges sewn to last. This umbrella provides ample shade and sun protection. It works great and is pretty much as expected. I do find the tilt feature a tad tricky sometimes, maybe becsuse I’ve got smaller hands idk, but other than that it’s great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
W
"WE WINN!!!"
Belleville, US
★★★★★ 4
Budget Baddie...
Color: Tan, Size: 9 Foot
This is a quality/durable self driven (me) beast of an umbrella replacement...It has good color and we chose the Tan 9ft. Easy usage for its weight class all while being budget friendly... atmospheric presence of richness & sturdiness, and very easy to open and close to adjust to this unit's comforts. I haven't put this umbrella out for the season as of yet... because the snow is still present on the grounds of New England! "WE WINN"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
S
Shane H.
Louisville, US
★★★★★ 5
Beautiful and works great.
Color: Navy, Size: 10 Foot, Color: Navy, Size: 10 Foot
I decided to try this because my old umbrella had seen better days and it was time to replace it. I am very pleased with the quality and the ease of assembly with this umbrella. It’s very sturdy and I like the quality of the fabric and the metal. It’s very easy to open and close and it makes my patio look great. It gives me the perfect amount of shade and the fabric thickness is perfect at keeping the harsh sunbeams from getting through. I also think the price is great for what you get. I would definitely recommend this umbrella because it’s made well and works well. It’s also very easy to clean. I just use my garden hose and spray it down and let it air dry. It also fit perfectly in the stand I already had and it works great. I am very happy I got to try this out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
E
E. Van Der Scratchy
Natrona Heights, US
★★★★★ 5
Great replacement patio table umbrella.
Color: Tan, Size: 10 Foot
After a windstorm destroyed my old umbrella on our patio set, I was looking for a new one that wouldn't break the bank but also held up to the direct sun of the summer months. This umbrella did not disappoint! The material part of the umbrella top seems like it is nice and thick and the stitching is overlapped in the corners which should provide a lot of strength for the windy days. I really like the neutral colors of the fabric, as that will go well with the rest of my outdoor furniture. The medal pole portion is perfectly straight and the pivot point connection seems nice and tight. I would think that this umbrella will stand the test of time. No assembly needed, just pull it out of the box and extend the fabric.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026

recommand products