SKU: 13349244771

CD40 Fc Chimera Protein, Human

Sale price$170.10 Regular price$189.00
Save 10%

Pay in installments of $47.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD40 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

50-60kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13349244771

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
David C. Olson
Battle Creek, US
★★★★★ 5
An Easy DIY Headlight Restoration Kit with Strong Appeal
Size: 1 Count (Pack of 1)
This restoration kit is appealing because it offers a way to improve cloudy or oxidized headlights without needing power tools. That makes it accessible for people who want to do the job themselves without investing in extra equipment. Cerakote also has a strong reputation in protective coatings, which gives this kit added credibility compared with generic restoration products. The biggest selling point is the promise of restoring clarity while adding a protective finish to help maintain the results. If the process is easy to follow and the wipes are effective, this can be a worthwhile DIY option for improving both appearance and nighttime visibility. For vehicle owners with faded headlights, this seems like one of the more convenient restoration approaches available.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
T
Verified Purchase
Tural Farziev
San Leandro, US
★★★★★ 5
Perfect
Size: 1 Count (Pack of 1), Size: 1 Count (Pack of 1)
Honestly one of the best headlight restoration kits I’ve used. The instructions were simple, the process was easy to follow, and the results were way better than expected. My headlights were heavily oxidized and yellow, and after using the 2000/3000 grit sanding steps with the ceramic coating, they looked almost brand new again. The ceramic finish made them crystal clear and glossy. Definitely worth the money and much better than cheap polish-only kits.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
C
Verified Purchase
cwin
Los Angeles, US
★★★★★ 5
Very happy with the outcome, worked perfectly
Size: 1 Count (Pack of 1)
I was very happy with the CERAKOTE Ceramic Headlight Restoration Kit. The instructions were simple to follow, and the whole process was much easier than I expected. My headlights were cloudy and dull before using it, but after completing the steps, they looked dramatically clearer and much closer to new. The kit included everything needed, and I liked that it did not require any extra tools or complicated equipment. The results made a noticeable difference in the appearance of the vehicle, and the headlights also seem brighter at night. Overall, this is a great product that does exactly what it claims. I would definitely recommend it to anyone looking for an affordable and effective way to restore foggy headlights.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
G
Verified Purchase
Gabrila
San Leandro, US
★★★★★ 5
Highly Recommend – Amazing Results on My Honda Accords!
Size: 1 Count (Pack of 1), Size: 1 Count (Pack of 1)
I recently used the Cerakote Headlight Restoration Kit on both my 2008 and 2014 Honda Accords, and I’m genuinely impressed. The headlights on both cars were badly oxidized, hazy, and yellowed from years of sun exposure. After following the kit’s instructions, they look crystal clear and almost like new again. The process is pretty straightforward and beginner-friendly. It does take roughly an hour per headlight set if you follow all the steps carefully and allow proper air drying time before the final clear coat. There’s a bit of elbow grease involved with the sanding and polishing stages, but nothing overly difficult. The kit provides everything you need, and the instructions are clear. The results are excellent! Both cars now have headlights that look factory-fresh. I’m really happy with how bright and clear they are at night. Best part? I saved a ton of money by restoring them instead of buying expensive OEM replacements. The only minor uncertainty is long-term durability (how well the clear coat holds up after a couple years of sun, weather, and car washes), but for the price and the dramatic improvement I saw, it’s absolutely worth it. I’d definitely buy this kit again if needed. Highly recommended for anyone dealing with cloudy headlights. Great product that delivers professional-looking results at a fraction of the cost!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
C
Verified Purchase
Cleaver
Boise, US
★★★★★ 4
Best product I've tried so far but still temporary. YMMV.
Size: 1 Count (Pack of 1)
This product really does work. It is the best I've used. I purchased in September 2024 and am writing this review in May of 2026, roughly one year and 8 months later. I noticed product failure a little after a year after application and it has been degrading slowly since. Currently the product is visible like a layer of clear paint flaking off and you can physically scratch some off. Here are the pros and cons. Pros: Clarity, relative ease of use, value Cons: Taping and sanding, doesn't last for as long as you own your car as claimed Best used as a temporary fix. Bottom line, would I use it again? Yes. What am I doing today? Replacing the headlights completely. Why? I plan on keeping my car for longer than a year.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products