SKU: 33953486449

SLAMF7/CRACC/CD319 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SLAMF7/CRACC/CD319 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP 12 Accession Q9NQ25 Amino Acid Sequence Ser23 Met226, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP-12
Accession Q9NQ25
Amino Acid Sequence

Ser23-Met226, with C-terminal Human IgG1 Fc SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

60-72kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Lee J K. et al. (2004) Molecular and functional characterization of a CS1 (CRACC) splice variant expressed in human NK cells that does not contain immunoreceptor tyrosine-based switch motifs. Eur J Immunol. 34(10): 2791-2799.

2、Tassi I. et al. (2005) The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates the PI3K and phospholipase Cgamma signaling pathways in human NK cells. J Immunol. 175(12): 7996-8002.

3、Lee J K. et al. (2007) CS1 (CRACC, CD319) induces proliferation and autocrine cytokine expression on human B lymphocytes. J Immunol. 179(7): 4672-4678.

4、Cruz-Munoz M E. et al. (2009) Influence of CRACC, a SLAM family receptor coupled to the adaptor EAT-2, on natural killer cell function. Nat Immunol. 10(3): 297-305.

Background

SLAM family member 7 (SLAMF7) is also known as CD2-like receptor-activating cytotoxic cells (CRACC), Membrane protein FOAP-12, CD antigen CD319, Novel Ly9, Protein 19A, which is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. Mature mouse CRACC consists of a 202 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33953486449

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chentao
Waukegan, US
★★★★★ 5
doggy toy chicken leg
Color: Yellow - Fried Chicken Leg
I bought this chicken leg toy for my dog and it quickly became one of his favorites. The yellow top part has two different sections — the very top makes a crinkly sound like paper when he bites it, and the middle squeaks when he chews or presses on it, which really keeps him interested. The white bottom part is super soft and easy for me to hold, so it’s great for playing tug or just interacting with him. The size is perfect for small dogs, but it might feel a bit small for larger breeds — that said, the material quality is really nice. Overall, it feels well made, fun, and keeps my dog entertained without getting bored. Definitely a good buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
X
Verified Purchase
xmiki
Charlottesville, US
★★★★★ 4
Fun, engaging, and cute toy for dogs!
Color: Yellow - Fish Skewer, Color: Yellow - Fish Skewer
I got the fried fish toy for my dog. So far, he really enjoys the squeaking noise and comes running every time he hears it. The toy material is pretty thick and is holding up well during playtime. The size of this toy is perfect for my small dog but it might be a bit small for larger dogs. Overall it's a fun and super cute toy for my pets that's become a favorite!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
G
Verified Purchase
Gin Fu
Carnegie, US
★★★★★ 5
Fun enrichment
Color: Yellow - Fish Skewer, Color: Yellow - Fish Skewer
Bought this to keep my dog busy while I’m out, and surprisingly it works. It’s soft, lightweight, and he was interested right away. Hiding treats inside turns it into a sniffing challenge that keeps him occupied longer than expected. The squeaker does its job, and the material feels gentle, but this is not for heavy chewers. If your dog destroys toys for sport, proceed with caution. Overall, it’s a fun enrichment toy that helps with boredom. Great for light to moderate play and dogs who don’t choose violence every day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026
C
Verified Purchase
chen
Fort Morgan, US
★★★★★ 5
Really cute and great for photos
Color: Yellow - Fried Chicken Leg, Color: Yellow - Fried Chicken Leg
This drumstick plush toy is super cute and looks great in pictures. My dog liked it right away and keeps carrying it around. It’s soft, lightweight, and the size is just right. We’ve already taken a few fun photos with it, and it would also make a nice little gift for someone with a dog. Simple, well made, and definitely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
B
BarbaraAnn
Dallas, US
★★★★★ 2
Don't Bother Unless You Have Something The Size of a Chihuahua
Color: Yellow - Fried Chicken Leg
Title is definitely deceiving. We have 2 Pitbulls and a Bull Terrier. They simply looked at this thing and it blew into pieces. These are more for smaller dogs. I wouldn't even say medium. It was just a big disappointment. I was excited to give them this toy, until it arrived and I saw how small it was.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2026

recommand products