SKU: 36864707516

FGFR3[K650Q] Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FGFR3[K650Q] ProteinProduct Specification Species Human Synonyms FGFR3[K650Q],FGFR3 Accession P22607 1 Amino Acid Sequence P436 T806(end)

Product Specification


Species Human
Synonyms FGFR3[K650Q],FGFR3
Accession P22607-1
Amino Acid Sequence

P436-T806(end)

PLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKQTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Expression System Baculovirus-InsectCells
Molecular Weight 67.8 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, 0.05% Brij35, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36864707516

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lilly
San Leandro, US
★★★★★ 4
Works well, worth buying.
Color: Rechargeable with Storage Stand and Box - Black
Works really well. I wish the attachments were easier to get off without feeling like you are going to break them. I use a butter knife to pry it off carefully. I like having the case too, it works well if you need to travel with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
J
Verified Purchase
Jill Maxon
Boise, US
★★★★★ 5
Little but mighty
Color: Rechargeable with Storage Stand and Box - Black, Color: Rechargeable with Storage Stand and Box - Black
Love this Frother. It stays charged for a good amount of time. The different speed settings are nice. Love the different attachments as they come in handy for multiple options in the kitchen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
S
Verified Purchase
Sal
West Palm Beach, US
★★★★★ 5
CIRCLE JOY Rechargeable Handheld Milk Frother Wand with Stand
Color: Rechargeable with Storage Stand and Box - Black
My wife is very with the product. It does everything as described in the listing. It very powerful and comes with 3 attachments and a stand. Love the rechargeable convenience. Cleaning is a snap. Highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
H
Verified Purchase
happycurls
Draper, US
★★★★★ 5
Reliable favorite kitchen tool
Color: Blue
This wonderful tool may be the most used tool in our kitchen. The hardest thing about it is to remember you can push the button and it runs- you don't have to hold it!. The charge on the rechargable battery last a long time- about 1 recharge per month- and we use it daily. We use the mixer attachment most. It works great for protein powders, collagen, iced tea or lemonade mix. It cleans easily and is waterproof- just make sure the cover is over the charging port. We have used it to froth milk, whip eggs, and as I said we use it daily to mix beverages. I worried about the price, but it is a great value because we bought it in December 2024 and it is more powerful and has already lasted longer than two whimpy ones.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2025
L
Verified Purchase
Link
San Leandro, US
★★★★★ 5
Quality
Color: Black
This is by far the best frother I've used. Battery life is great. Its UX is excellent. Feels nice in the hand and has great power. Also like the on/off button as opposed to haveing to hold a switch down. Looking forward to getting their s3 scale.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026

recommand products