SKU: 42531122523

CD40 His Tag Protein, Human

Sale price$315.00 Regular price$350.00
Save 10%

Pay in installments of $87.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD40 His Tag Protein, HumanProduct Specification Species Human Synonyms Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal 8*His EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Synonyms Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal 8*His

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

25-33kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. The extracellular domain has the cysteine rich repeat regions, which are characteristic for many of the receptors of the TNF superfamily. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Defects in CD40 result in hyper-IgM immunodeficiency type 3 (HIGM3), an autosomal recessive disorder characterized by an inability of B cells to undergo isotype switching, as well as an inability to mount an antibody-specific immune response, and a lack of germinal center formation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42531122523

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chief
Belleville, US
★★★★★ 4
Very nearly the perfect frother for all your basic frothing & mixing needs
Color: Black
There are a lot of middle-of-the-road frothers out there. I've been through a few of them in my recent search for something that could mix and froth well, without taking up any more outlets in my basement kitchen. Of the three Maestri frothers I've tried so far, this one wins the race by a nose. Most recently, these Maestri frothers come in basically three versions: A single-speed @ 8000 RPM, a two-speed @8000/5500 RPM, and this stepless variable-speed version. Aside from that, the only real difference in recent version pack-outs is which attachments they come with. Look over the reviews of the single-speed version and you'll find that while it can and does froth well, it starts at a single, high speed and gets there fast. This makes it pretty easy to spin liquid right out of most common cups and mugs. There is a two-speed version, but it's harder to find, only comes in one color (Grape Purple), and while it's much better than the Maestri single-speed, it still has a couple of quirks that make this variable-speed version win out. This mixes and froths whole milk, half-and-half, or heavy whipping cream, or just about anything else very well. Like all frothers, it takes a little time to learn its nuances and nail down the technique, this will definitely get you there. The best feature of this is easily the speed control. Turn the knob to turn it on at a low speed that's great to get things started, then turn the knob to crank up the speed just enough to do what you need, whether that's mixing or frothing. The low starting speed makes it easy to keep things under control without undue spilling, and the max speed is more than enough to make quick work of getting your froth on. There are really only two complaints I have with this stepless, variable speed version: - I'd really like to have a Press On / Release Off button in addition to the Speed Control knob. More than one time have I gone to turn this off, only to spin the knob the wrong way and crank the speed up to ludicrous, sloshing liquid on the counter. Being able to turn it Off just by letting go of the button would be quick and easy. This configuration would allow using a preferred speed right from the start, while still allowing speed to be adjusted on-the-fly when needed. - Give it a bigger battery. It would cost mere pennies to give this a 2000mAH+ instead of a 1200mAH battery, and I can't think of any reasonable downside to that. - Give the motor a little more torque. It's fairly easy for the current motor, at any speed, to get bogged down in a thick protein powder mix, or when pressing the frother or other attachment a bit too hard into the bottom or side of the frothing container. A bit more "oomph" would prevent that. I really like the overall design and features of thes Maestri frothers better than many other, cheaper versions. This variable-speed version is pretty great as it is and probably the one I would recommend over the single- or two-speed, for most people. But I often find myself using two hands -- one to hold it steady, and the other to turn it on and tweak the knob to the desired speed(s) -- for a device that should arguably need only one hand to use. Just a couple of minor tweaks as noted above would make this the overall best frother of its type that I've used.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2025
D
Verified Purchase
D. Smith
Fort Morgan, US
★★★★★ 5
Hands down, the BEST handheld frother I've ever used!
Color: Black
Hands down, the BEST handheld frother I've ever used! I got the black one, but any color will have the same results. Over the past 12 years or so, I've used so many different handheld frothers and they've ALL fallen short of expectations for quality, longevity, power, features, and usability. I've used everything from cheap, $15 models to $50+ models and everything in-between. Some with fancy attachments for various types of mixing, frothing, beating, whipping, etc. Some with rechargeable batteries, some without. Some AC powered, some with fixed whisks, some with detachable/replaceable whisks, some with stands, etc. NONE have been spectacular. Most broke within 6 months and got tossed. ALL were major disappointments in the end, including the "revered" Zulay models of which I tried several. I finally found this Maestri House branded, variable speed frother with detachable / replaceable whisks and got one to try. I was literally on Cloud Nine the first time I turned it on. Like, WOW! Not only was it FAST on the highest speed, but it was powerful enough to churn right through milk, eggs, cream, etc, without bogging down like many others. This thing makes milk froth like a milkshake and Matcha Lattes like nothing else I've ever experienced. I used to have to sift my Matcha, then whisk it in hot water, then froth milk and then blend them together to make the perfect latte. and if the milk was cold (my preference), pre-whisking in hot water was a must to avoid lumps. However, with THIS frother? I literally pour my milk into a tall tumbler, drop in un-sifted Matcha powder, and spin up the Maestri House frother at first on a medium low speed to get it mixed, then jump straight to the highest speed to really whip that milk and match up. After about 30-45 seconds, I've got the thickest, richest, smoothest, most aerated latte around. And NO LUMPS at all!!! What a time and dish saver! And cleaning? I just run it under hot running water to get the shaft cleaned and then spin it up in a dish with hot running water for a few moments, then spin it on high for a few seconds in the air to dry it off instantly. Now, I'll be honest here, too. The specs say it can go months on a charge, using it for a couple minutes a couple times daily. Well, I guess it could do that and still spin. But I use it FULL SPEED, churning hard for at least a minute a couple times per day. After about 2 weeks, I can start to notice a speed reduction so I just plug it back in on the charger. All things considered, this is still better than all the other handheld frothers I've used over the years. After using the heck out of this thing for the past 7 months, I've even decided to start selling these in our Japanese gift shop. The manufacturer is has been very responsive both in customer support (I called them about an issue I thought I was having, and they called me back with a couple hours even though I didn't leave voicemail when they didn't answer right away) and in reseller support. I have to give these guys an A+ for responsiveness and quick resolution when problems might arise. HIGHLY recommended!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 17, 2025
H
Verified Purchase
Hawaii Keith
Dallas, US
★★★★★ 5
Great Addition!
Color: Black
Why did you pick this product vs others?: I just started a powdered drink routine recently and was having a difficult time mixing it with water. I would consistently end up with small nuggets of mix making it unenjoyable to drink. I knew I needed a mixer and was glad I found this device when I did. It works perfectly! I like the fact that it comes with its own stand and included two mixing heads. It is solid, well-designed, and you can feel the quality when you pick it up. The variable speed of the mixer is perfect for ensuring that everything is blended well. I haven’t used it to “froth” anything yet, at least not on purpose, but I accidentally found out that it can do that well. This is a great addition to our kitchen and is very easy to wash after use. So far…no issues. Highly recommend for those of you looking for the right tool to make sure those protein mixes aren’t full of unmixed nuggets.  
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 21, 2025
S
Verified Purchase
Suzi blue
Cuba, US
★★★★★ 4
Low foam
Color: Black
Love this frother. It is great quality and the turn speed is amazing. My only issue is this. It comes w 2 wands and they are both singles. The single is great for stirring things up. It does not make a lot of froth and for some things it’s perfect but sometimes I like a lot of froth and I wish it either came w a single and a double or you could purchase a double separately to intermix. I don’t want to buy a whole other unit just for the double. I wrote to them bc the double frother they sell doesn’t look as good as this one but sometimes a girl needs a lot of foam and sometimes th stirring is perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
H
Verified Purchase
Hanna
Pawtucket, US
★★★★★ 5
Still The Best Frother Ever!
Color: Black
I love how it is easy to use, how it holds a charge, and how much power it has. I've only charged it once since I got it & I've been using it on a daily basis!!! Though it isn't a long time, I'm happy with it so far! I definitely will recommend it to anyone looking for a great frother. If you are looking for one, look no further! You won't be disappointed! I've read some comments where they found it to be too strong that their drink spilled everywhere. But for me I have not had any incident of spilling over. I have used it both for my coffee and my matcha tea and it worked great without any spilling over. You just have to start with the lowest power and ensure that you have a large enough container to have a room for your frothing. My sister tried to use it recently during her visit to make us matcha tea. However, she experienced spillage all over the cup, because she had used a small cup. Otherwise, she liked it very much and said she will get one when her battery operated one stops working... Another thing I like about the product was the customer service that I had received. When I got my first order which came quickly, it wasn't working after having charged it over 24 hours. It was not turning on at all. I returned it and ordered a replacement which I received within a day or two. This time after charging it for the recommended amount of time, I was a bit skeptical when I turned it on. However, I was pleasantly surprised that it worked like it was supposed to and it has been working ever since having charged it only once so far. I may come back and give an update depending on how it does after 6 months of use, so keep in tune... I don't know if there is a way to write a new entry as a follow up to the old entry, so I'm going to add my follow up comment over here. May 23, 2025 - I love my frother more than I can say in words. It's functionality has not changed a bit from the time I have purchased it. It charge lasts several weeks to few months before I charge it again and the power is still the same. Recently I decided to buy another one for my office use. I like the white color and so tried it but that one wouldn't even turn on. And then I got a gray one to have a different color. That one was much weaker than the black one I own. Then I replaced it with another gray one within few days. I tried it and it was exactly the same as the one I already replaced. So then I decided to go with a black one again hoping that it would be the same as the one I have. The black one did much better than the gray ones in the strength or power of the frother. However, it is weaker than the one I already have been using since last August. While I am not very happy with the quality being inconsistent in all of the ones I have tried including the recent pictures of the black one, I have decided to keep the black one because it is relatively better than the gray ones I tried. What I don't understand is why there is inconsistency in the quality of the same product by the same maker. I am beginning to wonder if the black one I purchased in Augusta last year was anomaly of a quality and a good way. Maybe I lucked out on my older black frother, but I'm unsure if quality is going to get better if I were to order another one. I have a sister who is a pro in making coffee drinks and she was the reason I had ordered this frother to begin with. She uses a battery operated one at this time and I have been thinking about getting her one like mine. While I am still skeptical, I am going to give it a shot and order her one sometime soon. If it doesn't work, I guess we will return it back. But one thing that I am grateful is that I have been able to return every one of those that I have tried recently with no issues. I hope that I don't have to return my most recent purchase in black. I was not even able to review the new purchase because of the item being the same color which is crazy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2024

recommand products