SKU: 4376509055

Human NF-H(Neurofilament heavy polypeptide) , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NF-H(Neurofilament heavy polypeptide) , His tagProduct Specification Species Human Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH Accession P12036 Amino Acid Sequence Protein sequence(P12036, Met1 Gln100, with C 10*His) MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 5kDa Actual: 11 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms 200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH
Accession P12036
Amino Acid Sequence

Protein sequence(P12036, Met1-Gln100, with C-10*His)
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.5kDa Actual:11-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament, heavy polypeptide (NEFH) is a protein that in humans is encoded by the NEFH gene.It is the gene for a heavy protein subunit that is combined with medium and light subunits to make neurofilaments, which form the framework for nerve cells.Mutations in the NEFH gene are associated with Charcot-Marie-Tooth disease. Neurofilament heavy (NEFH) is one of the critical proteins required for the formation of the neuronal cytoskeleton and polymorphisms in NEFH are reported as a rare cause of sporadic ALS (sALS).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4376509055

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
leonardo
Fort Morgan, US
★★★★★ 5
Great quality and solved my space problem
Color: Natural - Rectangle, Size: 6-panel
I bought this room divider to separate my bedroom and create a private area for my clothing racks. It completely exceeded my expectations. The quality is excellent, the material feels sturdy, and it arrived in perfect condition. The delivery was also very fast, which was a big plus. What I loved the most is how well it works as an actual divider. I opened it almost all the way, leaving just a small fold, and it sits exactly the way I wanted. For extra stability, I added double sided tape on the floor, and that kept everything perfectly in place. Overall, it did exactly what I needed. It looks beautiful, it is functional, and it helped a lot with organizing my space. I definitely recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 21, 2025
M
Verified Purchase
mariela castelblanco
Omaha, US
★★★★★ 5
Love it
Color: Natural - Rectangle, Size: 4-panel
Pretty no much stability but work for me
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
E
Verified Purchase
Electromagicforce
Louisville, US
★★★★★ 4
Chic and simple
Color: Natural - Rectangle, Size: 4-panel, Color: Natural - Rectangle, Size: 4-panel
When fully unfolded this is a great room divider. Folded up, it does not stand well on its own. I had some issues upon arrival and the seller took care of it for me, just somewhat slowly. These are pricey for how the quality feels, but it gets the job done as a privacy screen for the office area in our apartment.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 16, 2024
L
Verified Purchase
lenedel
Lake Worth, US
★★★★★ 5
Looks great.
Color: Natural - Rectangle, Size: 4-panel
Looks soft around the room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
S
Verified Purchase
Shania Roy
Omaha, US
★★★★★ 5
Very nice for the price! Don’t regret buying it
Color: Natural - Rectangle, Size: 6-panel, Color: Natural - Rectangle, Size: 6-panel
Better than I thought. I bought it for my remote job and it blocks everything out perfectly. * Came pre-built (thank goodness), sturdy, & no tears/rips in the “fabric”. * Everything is in good shape. * Folds up nicely * Doesn’t tip over easily (you gotta put some force into it). * It’s not transparent, however, light does filter through and if someone is standing or walking close to the divider (like a few inches away from the divider) you can see a shadow/a figure. * I have a standing desk and it still covers everything (I’m 5’6” & my camera gets about to 6’4ish) Photos are of me sitting & standing and the dividers still covering my entire background minus my ceiling light fixture
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026

recommand products