SKU: 65118684993

ST6/CD82 His Tag Protein, Human

Sale price$356.40 Regular price$396.00
Save 10%

Pay in installments of $99.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ST6/CD82 His Tag Protein, HumanProduct Specification Species Human Antigen ST6 CD82 Synonyms KAI1, SAR2, TSPAN27 Accession P27701 1 Amino Acid Sequence Gly111 Leu228, with C terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 30kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Antigen ST6/CD82
Synonyms KAI1, SAR2, TSPAN27
Accession P27701-1
Amino Acid Sequence

Gly111-Leu228, with C-terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Jin?Woo Lee,Yoo?Wook Kwon, Cheong?Whan Chae, Jae?Il Choi, Injoo Hwang,Ji?Yeon Yun, Jin?A Kang, Young?Eun Choi, Young Hyun Kim, Sang Eun Lee. KAI1(CD82) is a key molecule to control angiogenesis and switch angiogenic milieu to quiescent state. Lee et al. J Hematol Oncol (2021) 14:148 https://doi.org/10.1186/s13045-021-01147-6.

Background

KAI1/CD82, a transmembrane protein and a member of the tetraspanin superfamily, is an evolutionally conserved molecule expressed in various tissue types. First identified to be involved in the T cell activation process, KAI1 is typically considered as a suppressor of metastasis. Most studies of KAI1 examined its function in suppressing metastasis and angiogenesis mainly in cancer cells and endothelial cells. Recently, we and others have reported that KAI1 regulates the cell cycle progression of the long-term repopulating hematopoietic stem cells (LT-HSCs) and muscle stem-progenitor cells. Thus, KAI1 has different roles in each cell and organ type.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65118684993

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amos
Houston, US
★★★★★ 5
Smooth and quiet wipe
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow, Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
Swapped these onto my car and they work great. Installation was quick and easy, took just a couple minutes. The wipe is smooth and quiet with no streaks, even in heavier rain. Feels like a solid upgrade compared to cheaper blades I’ve used before. So far very satisfied.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
P
Verified Purchase
Perez
Whiting, US
★★★★★ 4
Great fit...but 1" shorter
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
Fit and quality is great. However the shortblade needs to be 21". OEM is26" and 21". Bosch sets 26 and 20". I may have missed, but I didnt t see anyone mentioning this issue. Other than that is perfect fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
F
Verified Purchase
Fat Kat
Birmingham, US
★★★★★ 5
Terrific Bosch blades
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow, Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
These German made wiper blades do their job so well that my wife was impressed. Once you get the hang of it they are one minute to replace. Recommend placing a cloth under the blade to avoid any windshield scratches if the metal wiper assembly accidentally falls down on the glass. Nice to see the Bosch name on the wiper blades.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
M
Verified Purchase
Marco L.
San Leandro, US
★★★★★ 5
Best replacement option for 2025 Tesla Model Y Performance
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow, Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
Outstanding replacement option for 2025 Tesla Model Y Performance (Pre-Juniper), so much smoother than the OEM wipers. Very easy to replace. They seem very durable after testing on all wiper settings. Definitely keep the windshield clearer without streaks. Seem to also have more stability on mounting compared to OEM option. 15/10 replacement for the cost, can’t beat it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
M
Verified Purchase
mfair
Battle Creek, US
★★★★★ 5
Great replacement set of wiper blades for 2024 CR-V! Work great & easy replacement!
Size: 24"+19"+10"(Top Lock)
Excellent wiper blade set for my 2024 Honda CR-V - a perfect fit! Easy to replace the front blades and these are very quiet and do a great job with no streaking at all. Instructions included for the front blades are good. Either lost or couldn't find the rear window instructions, so went on YT for a quick video (for removing the old blade - installation is super easy) and it was an easy replacement. Replaced OEM blades, and these are every bit as good and the price is good. Old blades lasted a couple years, don't think I'll wait that long this time - these are nice blades and easy to replace and worth replacing every year. Very smooth, no streaking, quiet... in short they work great! Recommend for your CR-V - per above they're as good or better than OEM blades. New year with new wiper blades!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025

recommand products