SKU: 68090964206

Mouse IFN-alpha1 Protein, His Tag

Sale price$31.50 Regular price$35.00
Save 10%

Pay in installments of $8.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IFN-alpha1 Protein, His TagProduct Specification Species Mouse Synonyms Interferon alpha 1, IFN alpha 1, Ifna1 Accession P01572 Amino Acid Sequence Protein sequence (P01572, Cys24 Lys189, with C His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed MW: 20 kDa Purity 95% by SDS PAGE

Product Specification


Species Mouse
Synonyms Interferon alpha-1, IFN-alpha-1, Ifna1
Accession P01572
Amino Acid Sequence

Protein sequence (P01572, Cys24-Lys189, with C-His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interferon alpha-1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68090964206

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
nancy lischer
Fort Morgan, US
★★★★★ 1
My last Timex and why.
Color: Black/Gray/Digital, Color: Black/Gray/Digital
New edit. Upon further reflection, I’ve only had, a couple of exploratory years with Swatch excepted, Timex watches. My first one was when my mother replaced the Chicita Banana “tickity tock” sticker with a real Timex wind up watch before my first Cub Scout camp. In addition to many other Timex products, I’ve had these Ironman watches for the past 25+years. Usually the band wears out and can’t be replaced after three or four years. This particular watch fell apart less than six weeks old. It wasn’t hit by impact. It just came apart while I was driving down the road. I wonder if they’ve changed their manufacturing process. See photo for details. What is truly infuriating is that rather than replacing it, because it is truly a warranty issue, the told me to ship it to their offshore repair facility (which could take 3-5 months) and pay what might be half the value of the watch. Things happen, but the intentional friction they have created to avoid their obligations borders on malpractice and speaks to their indifference toward customer experience and subsequent lifetime value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2025
M
Verified Purchase
mike
Alexandria, US
★★★★★ 5
Good watch
Color: Black/Black/Digital
Bought for my 8 yo, durable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2025
K
Verified Purchase
Katelyn Vincent
Grantham, US
★★★★★ 5
As expected
Color: Gray/Gray/Digital
Just an old school digital timex. Tried and true. Has both 12hr and 24hr function on the time setting. Has a standard stop watch and timer. The battery is great, just as it always is on a timex. Good water resistance and very easy to use. Overall very good watch for the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 6, 2025
D
Verified Purchase
David C. Gilliam
Carnegie, US
★★★★★ 2
Can’t read numbers
Color: Gray/Gray/Digital
Numbers are too small to tread on a 44mm watch
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
H
Verified Purchase
hal lifson
Dallas, US
★★★★★ 5
Love the Timex Ironman Shock watches!!
Color: Black/Black/Digital
I really like the Timex Ironman Shock watches. They are very durable and reliable. Simple to use and modeled after the. Original Ironman watches of the late 80s and 90s. Buttons are clearly marked and easy to press. They used to make many colors of this Shock model of the watch inc a cool shiny red color my wife still has . I have been a runner many many years and at 65, am still out although a lot slower than my 20s. But Timex Ironman watches have. Been my constant companion on the roads and track for 35 years now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026

recommand products