Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 17 - Jul 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Renin, His TagProduct Specification Species Human Accession P00797 Amino Acid Sequence
Product Specification
| Species | Human |
| Accession | P00797 |
| Amino Acid Sequence | LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 44.0 kDa (reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles. |
Background
Renin, also known as angiotensinogen enzyme, is a proteolytic enzyme released by paraspheroidal granulosa cells and is part of the renin-angiotensin system. Renin acts on plasma angiotensingen to produce inactive angiotensin I, which is hydrolyzed to active angiotensin II under the action of angiotensin converting enzyme. Angiotensin II can cause arteriolar vasoconstriction and promote the synthesis and secretion of aldosterone in adrenal cortex. Plasma Renin activity test can be used to diagnose primary aldosteronism and hypertension.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy