Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human GZMB , His tagProduct Specification Species Human Synonyms C11, CTLA 1, Cathepsin G like 1 (CTSGL1), Cytotoxic T lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin 2, Granzyme 2, Human lymphocyte protein (HLP), SECT, T cell serine protease 1 3E, CGL1, CSPB, GRB Accession P10144 Amino Acid Sequence Protein sequence(P10144, Gly19 Tyr247, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | C11, CTLA-1, Cathepsin G-like 1 (CTSGL1), Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin-2, Granzyme-2, Human lymphocyte protein (HLP), SECT, T-cell serine protease 1-3E, CGL1, CSPB, GRB |
| Accession | P10144 |
| Amino Acid Sequence | Protein sequence(P10144, Gly19-Tyr247, with C-10*His) GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:27.4kDa Actual:33kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Granzyme B (GZMB) is one of the serine protease granzymes most commonly found in the granules of natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodelling.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 18 reviews
Sort
Product Reviews
★★★★★ 5
Smooth and quiet wipe
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow, Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
Swapped these onto my car and they work great.
Installation was quick and easy, took just a couple minutes. The wipe is smooth and quiet with no streaks, even in heavier rain.
Feels like a solid upgrade compared to cheaper blades I’ve used before.
So far very satisfied.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
★★★★★ 4
Great fit...but 1" shorter
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
Fit and quality is great. However the shortblade needs to be 21". OEM is26" and 21". Bosch sets 26 and 20". I may have missed, but I didnt t see anyone mentioning this issue.
Other than that is perfect fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
★★★★★ 5
Terrific Bosch blades
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow, Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
These German made wiper blades do their job so well that my wife was impressed. Once you get the hang of it they are one minute to replace. Recommend placing a cloth under the blade to avoid any windshield scratches if the metal wiper assembly accidentally falls down on the glass. Nice to see the Bosch name on the wiper blades.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
★★★★★ 5
Best replacement option for 2025 Tesla Model Y Performance
Size: Combo Pack (26" & 20"), Style: Top Lock Narrow, Size: Combo Pack (26" & 20"), Style: Top Lock Narrow
Outstanding replacement option for 2025 Tesla Model Y Performance (Pre-Juniper), so much smoother than the OEM wipers. Very easy to replace. They seem very durable after testing on all wiper settings. Definitely keep the windshield clearer without streaks. Seem to also have more stability on mounting compared to OEM option. 15/10 replacement for the cost, can’t beat it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
★★★★★ 5
Great replacement set of wiper blades for 2024 CR-V! Work great & easy replacement!
Size: 24"+19"+10"(Top Lock)
Excellent wiper blade set for my 2024 Honda CR-V - a perfect fit!
Easy to replace the front blades and these are very quiet and do a great job with no streaking at all. Instructions included for the front blades are good. Either lost or couldn't find the rear window instructions, so went on YT for a quick video (for removing the old blade - installation is super easy) and it was an easy replacement.
Replaced OEM blades, and these are every bit as good and the price is good. Old blades lasted a couple years, don't think I'll wait that long this time - these are nice blades and easy to replace and worth replacing every year. Very smooth, no streaking, quiet... in short they work great!
Recommend for your CR-V - per above they're as good or better than OEM blades. New year with new wiper blades!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
recommand products
Tanabe Sustec Front Strut Tower Bar 00-05 Celica (ZZT231) - TTB036F
188.10
KW Coilover Kit V3 BMW 7series E38 (7/G); all models - 35220029
1547.00
Centric 01-06 Acura MDX / 03-08 Honda Pilot Performance Rear Brake Pads - 306.08650
51.02
Tanabe NF210 Springs 15-16 Honda HR-V AWD - TNF195
266.00
KW Coilover Kit V3 BMW M5 E60 (M560)Sedan (excludes EDC unit) - 35220046
2097.00