Pay in installments of $62.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
SIRP-α/CD172A His Tag Protein, MouseProduct Specification Species Mouse Antigen SIRP Synonyms BIT, Brain Ig like molecule with tyrosine based activation motifs, CD172 antigen like family member A, Macrophage fusion receptor, MFR, MYD1, P84, protein tyrosine phosphatase, non receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS1, SHPS1CD172A, Signal regulatory protein alpha 2, SIRP alpha Accession P97797 1 Amino Acid Sequence Lys32 Asn373, with C terminal 10*His
Product Specification
| Species | Mouse |
| Antigen | SIRP-α |
| Synonyms | BIT, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, Macrophage fusion receptor, MFR, MYD1, P84, protein tyrosine phosphatase, non-receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS1, SHPS1CD172A, Signal-regulatory protein alpha-2, SIRP alpha |
| Accession | P97797-1 |
| Amino Acid Sequence | Lys32-Asn373, with C-terminal 10*His KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-90kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Barclay, A.N. & M.H. Brown (2006) Nat. Rev. Immunol. 6:457. 2. vanBeek, E.M. et al. (2005) J. Immunol. 175:7781. 3. Liu, Y. et al. (2005) J. Biol. Chem. 280:36132. 4. Kharitonenkov, A. et al. (1997) Nature 386:181. |
Background
Signal regulatory protein alpha (SIRP alpha, designated CD172a), also called SHPS-1 (SHP substrate 1) and previously, MyD-1 (Myeloid/Dendritic-1), is a monomeric ~90 kDa type I transmembrane glycoprotein that belongs to the SIRP/SHPS (CD172) family of the immunoglobulin superfamily. SIRPs are paired receptors, with similar extracellular domains but differing C-termini and functions. The 503 amino acid (aa) human SIRP alpha contains a 342 aa extracellular domain (ECD), with one V-type, and two C1 type Ig domains, and three potential N glycosylation sites. It has a 110 aa cytoplasmic sequence with ITIM motifs that recruit tyrosine phosphatases SHP-1 and SHP-2 when phosphorylated. SIRP alpha is expressed mainly on myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It is also found on neurons, smooth muscle and endothelial cells. SIRP alpha shows adhesion to the ubiquitous CD47/IAP (integrin associated protein), while SIRP gamma binds more weakly and SIRP alpha 1 does not bind at all. Mouse and human SIRP alpha -CD47 binding only cross-reacts for specific polymorphisms and influences engraftment of xenotransplanted stem cells. SIRP alpha engagement generally produces a negative regulatory signal. Low SIRP alpha recognition of CD47, which occurs on aged erythrocytes or platelets or xenogenic cells, promotes clearance of CD47low cells from circulation. SIRP alpha recognition of surfactants SP-A and SP-D in the lung can inhibit alveolar macrophage cytokine production.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy