Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
EphA7 His Tag Protein, HumanProduct Specification Species Human Antigen EphA7 Synonyms EHK 3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein Accession Q15375 1 Amino Acid Sequence Gln28 Val555, with C terminal 10*His
Product Specification
| Species | Human |
| Antigen | EphA7 |
| Synonyms | EHK-3 Protein, EHK3 Protein, EK11 Protein, EPHA7 Protein, HEK11 Protein |
| Accession | Q15375-1 |
| Amino Acid Sequence | Gln28-Val555, with C-terminal 10*His QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 68-75kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1． Xiangyi Chen, Dechen Yu, Haiyu Zhou, Xiaobo Zhang, Yicun Hu, Ruihao Zhang, Xidan Gao, Maoqiang lin, Taowen Guo & Kun Zhang Clinical and Translational Oncology volume 24, pages1274-1289 (2022). |
Background
Ephrin-a receptor 7, also known as EphA7, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. At the same time, in recent years, more and more studies have shown that EphA7 protein is abnormally expressed in a variety of malignant tumors, involved in tumor occurrence and metastasis, and correlated with patient prognosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy