SKU: 86867487694

CD3 delta His Tag Protein, Cynomolgus

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD3 delta His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms T3D, CD3 DELTA, CD3D Accession 95LI8 Amino Acid Sequence Phe22 Ala105, with C terminal 8*His FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHHHH Expression System HEK293 Molecular Weight 20 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Cynomolgus
Synonyms T3D, CD3-DELTA, CD3D
Accession 95LI8
Amino Acid Sequence

Phe22-Ala105, with C-terminal 8*His

FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3 delta, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3 delta plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86867487694

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
cara
Natrona Heights, US
★★★★★ 5
Great privacy screen
Size: 6 Panel-119"W, Color: Beige
I have a studio apartment and the bathroom is in my bedroom. I bought this to section the area off so guests can use my bathroom without seeing my entire bedroom. This is perfect for that! It looks very nice and offers alot of privacy. The screen is fabric and good quality! I’m a middle aged woman and put it together myself in about 2 hours. Love this!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2025
M
Verified Purchase
michael cornwell
Lexington, US
★★★★★ 4
Nice divider 6 panel with wheels.
Size: 6 Panel-119"W, Color: Black, Size: 6 Panel-119"W, Color: Black
The wall works great , and I put it together by myself. I only gave it what I did because I have to move one or two of the panels on one end around a bit daily to make an opening to pass through. I find I have to check the screws that hold those legs/feet on frequently and retighten them. Beyond that everything was pretty good quality. (I ended up magnetizing an Allen wrench to one of the feet.) I also put on motion lights to the rollers so you’ll see them and don’t trip.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026
C
Verified Purchase
Carol
Carnegie, US
★★★★★ 5
Room divider
Size: 6 Panel-119"W, Color: Black, Size: 6 Panel-119"W, Color: Black
I was looking for something to separate my two boys and give them both their own space. So far this room divider has worked well. It’s 6 feet tall and the fabric is dark and thick. You won’t see anything on the other side. Good quality and easy to assemble ✅
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2024
K
Verified Purchase
Karen Moran
Pawtucket, US
★★★★★ 1
Too Cumbersome
Size: 6 Panel-119"W, Color: Black
Didn’t realize there were over 100 pieces to put this thing together. Had I been advised of that I would not have ordered this thing. Wayyyyy too much of a production to put it together. Nope. Returned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
L
Verified Purchase
LRL
Grantham, US
★★★★★ 3
Great Product, But Non-Existent Seller Support
Size: 6 Panel-119"W, Color: Black, Size: 6 Panel-119"W, Color: Black
The Good: Well Designed: Sturdy and aesthetically pleasing. Effective: Perfectly obstructs the afternoon sun glare from my monitor screens. Moderate Assembly: Straightforward and easy for the most part. The Bad: Defective Part: One crossbar end was missing threads, preventing the assembly of the sixth panel. Zero Communication: I emailed the seller as instructed and waited 8 days with no acknowledgment. Return Logistics: Amazon offered a return, but the box is heavy, and disassembly/repackaging would be a major task. Final Verdict I really like this product, but I’m deducting two stars for a total lack of customer service. I’ve decided to buy tools and fix it myself rather than deal with a heavy return. I hope the seller sees this and reaches out. The lesson learned is to check every part of a product before assembly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2026

recommand products