Pay in installments of $55.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
NKp30/CD337 Fc Chimera Protein, HumanProduct Specification Species Human Accession O14931 Amino Acid Sequence Leu19 Thr138, with C terminal human IgG1 Fc
Product Specification
| Species | Human |
| Accession | O14931 |
| Amino Acid Sequence | Leu19-Thr138, with C-terminal human IgG1 Fc LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 55-65 kDa(Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Natural killer protein 30 (NKp30; also known as natural cytotoxicity receptor 3, NCR3; or CD337) is an Ig-like activating receptor of NK cells regulating the cross talk between NK and dendritic cells. It is expressed on the surface of NK cells, recently-expanded γδT cells, activated CD8 cells, and innate lymphocytes. The extracellular part of NKp30 consists of a single N-terminal Ig-like domain, followed by a distinct 15 amino acids long stalk region proximal to the plasma membrane, which is important for receptor signaling. Further, three specific cellular ligands of NKp30 have been identified. NKp30 binds a member of B7 family, in particular B7 homolog 6 (B7-H6). Interaction of NCR3 with B7H6 leads to activation of NK cells and induces cytolysis of target cells resulting in apoptotic cell death. Another NKp30 cellular ligand, BAG-6 is recruited to the cell membrane and interacts with NKp30 in some tumor cells or under the stress conditions. The most recently discovered NKp30 ligand, galectin 3, expressed on the surface of some tumors, almost completely blocks NK cell cytotoxicity.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy