SKU: 9157598489

Human CGA, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGA, His tagProduct Specification Species Human Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG alpha); Follicle stimulating hormone alpha chain (FSH alpha); Follitropin alpha chain Accession P08515 Amino Acid Sequence Protein sequence(P01215, Ala25 Ser116, with C 10*His)

Product Specification


Species Human
Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG-alpha); Follicle-stimulating hormone alpha chain (FSH-alpha); Follitropin alpha chain
Accession P08515
Amino Acid Sequence

Protein sequence(P01215, Ala25-Ser116, with C-10*His)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.8kDa Actual: 25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone are heterodimers consisting of alpha and beta subunits that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9157598489

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mara
New York, US
★★★★★ 2
Weirdest armhole proportions I've seen
Size: X-Large, Color: Navy/Sage Green, Size: X-Large, Color: Navy/Sage Green
There are a few nice things about these tanks -- I like the colors, there's a little extra length in the back, and the fabric is a thick quality fabric. I appreciate the fact they're 100% cotton and was looking forward to wearing these. Overall, the tanks fit as I would expect for the size. But what in the world is up with the dimensions for the arm holes? There is a significant amount of extra fabric that bunches up and looks awful (see photos) I've never had this happen on a tank top before, even one that's a size up. It's really strange and I'm disappointed that I can't keep these because of it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
E
Verified Purchase
Elisabet
Omaha, US
★★★★★ 5
Comfortable Sleep Tanks, Weird Fit for Daytime
Size: Small, Color: Hot Pink/Oatmeal Heather
These 100% cotton tanks are perfect tops to wear at home: soft, breathable, and great for sleeping or lounging. The pink is extremely bright (borderline highlighter), while the beige is a much more wearable, calm color. The fit is a little odd on me—something about the cut just doesn’t sit right—so I wouldn’t wear them out of the house, but as a comfy bedtime set of two, they do the job.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
F
Verified Purchase
FC
Omaha, US
★★★★★ 4
Very reasonable price for the quality
Size: Small, Color: Navy/Sage Green
The tank tops are well-made with quality fabric. I like the subdued colors, too. Unfortunately the tank tops don't fit me well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
L
Verified Purchase
Laurel R
Whiting, US
★★★★★ 5
Classy cut
Size: Large, Color: Black
Good quality tank. Just what I was looking for. Not too short for my long torso. I’m 165 lbs and the large was just right. I’m over 60 and I don’t prefer a tight fitting tank top any more. I want a skim the body look with a bit more arm coverage. These look classy. I got the black and will order the bone color next. I will hang to dry but some reviews say it doesn’t shrink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
T
Verified Purchase
TitaniumGirl
Birmingham, US
★★★★★ 4
Super baggy
Size: Medium, Color: White
I’m Taking away one star for the bagginess and length of the top It’s super long I kept the top because the fabric is super soft, drapes nicely in the front, and can be used to wear under a blazer or on a beach Fabric has been washed and dried several times and has held up nicely Some minor wrinkles
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 20, 2025

recommand products