SKU: 95621400

IL-13 Protein, Cynomolgus

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-13 Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin 13 Accession Q0PW92 Amino Acid Sequence Ser21 Asn132, with N terminal 8*His HHHHHHHHGGGSSPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN Expression System HEK293 Molecular Weight 25 40kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Cynomolgus
Synonyms ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin-13
Accession Q0PW92
Amino Acid Sequence

Ser21-Asn132, with N-terminal 8*His HHHHHHHHGGGSSPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Expression System HEK293
Molecular Weight

25-40kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Comparative Study Protein Expr Purif . 1998 Mar;12(2):239-48.

Background

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. Interleukin 13 is a single-chain glycosylated polypeptide, which belongs to the IL-13/IL-4 family. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains. Recent studies have shown that human interleukin-13 has many structural similarities with human interleukin-4 and is produced by gene replication events. As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases.Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95621400

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jim Chan
Bozeman, US
★★★★★ 5
Doggy getting warmed up to his latest toy
Size Name: Large, Style Name: Octopus, Size Name: Large, Style Name: Octopus
This is a huge push toy for the size of my chihuahua. He gets a bit overwhelmed by the size at first but slowly warmed up to it. Can foresee he will be playing with this toy for a long time. Had quite a few toys from GoPet. Most of it still going strong after months of play.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in Singapore on 24 February 2024
M
Verified Purchase
Melvin Phua
Draper, US
★★★★★ 5
Great and safe product.
Size Name: Small, Style Name: Checkers, Size Name: Small, Style Name: Checkers
My dog loves his chicken pal, and it’s tough as nails! as compared to other cheaper alterntives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in Singapore on 15 December 2024
B
Verified Purchase
Biscuit fan
Houston, US
★★★★★ 1
Eyes on toy are dangerous for dogs
Size Name: Mini, Style Name: Checkers, Size Name: Mini, Style Name: Checkers
I’ve bought several Go Dog products and they have all been excellent. My dog adores the textures, robustness and squeak, plus the imaginative design. This one though is sadly not we’ll though out because of the eyes. Fragile and easy to pull off the dog can open them and eat the stuffing and become Ill. As happened Christmas 2021. Please take heed and change the eyes on this product. Thanks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in Singapore on 26 December 2021
F
Verified Purchase
Faith
Carnegie, US
★★★★★ 5
product was sturdy and good
Size Name: Large, Style Name: Octopus
the toy was sturdier than i thought. Boight it for my golden for christmas so ill see how long itll last her.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in Singapore on 9 December 2023
N
Verified Purchase
Nicola Thomas
Port Orchard, US
★★★★★ 5
So many squeaky bits
Size Name: Large, Style Name: Octopus
While my dog destroyed the main squeaky bit in the body, most of the legs so have squeaky bits too so it keeps him entertained. Well recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in Singapore on 1 February 2024

recommand products