SKU: 99410525680

IL-13 Protein, Cynomolgus

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-13 Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin 13 Accession Q0PW92 Amino Acid Sequence Ser21 Asn132, with N terminal 8*His HHHHHHHHGGGSSPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN Expression System HEK293 Molecular Weight 25 40kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Cynomolgus
Synonyms ALRH, BHR1, MGC116786, MGC116788, MGC116789, P600, Interleukin-13
Accession Q0PW92
Amino Acid Sequence

Ser21-Asn132, with N-terminal 8*His HHHHHHHHGGGSSPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Expression System HEK293
Molecular Weight

25-40kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Comparative Study Protein Expr Purif . 1998 Mar;12(2):239-48.

Background

Interleukin-13 is a cytokine which is secreted by activated T lymphocytes and primarily impacts monocytes, macrophages, and B cells. Interleukin 13 is a single-chain glycosylated polypeptide, which belongs to the IL-13/IL-4 family. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4Rα) and at least one of two known IL-13-specific binding chains. Recent studies have shown that human interleukin-13 has many structural similarities with human interleukin-4 and is produced by gene replication events. As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases.Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99410525680

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Trina2Cute
Lexington, US
★★★★★ 1
Poor Quality
This suit was for my nephews school dance. The look is great however, its not of good quality. The material is cheap and looks as though it should be a costume. When my nephew tried it on it looked baggy. I returned the suit but have yet to receive a refund.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2024
C
Verified Purchase
Che
Louisville, US
★★★★★ 5
My son usually wears a Xl in men's clothing, suggests to go up 1 size to be safe
Size: XX-Large, Color: Navy With Blue, Size: XX-Large, Color: Navy With Blue
My son and I picked this suit out for his prom night coming up in May 2026. He trird it on and it fits, looks, and feels great on him!!! Color was spot on to what we wanted.. And how the picture looks is how it exactly came. He ordered a XXL, is 5'9" and weighs 235lbs
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026
R
Verified Purchase
rose
Massapequa, US
★★★★★ 5
Awesome Suit!!
I purchased this suit for my boyfriend to wear to a party. I ordered an XL, he is 6'6" and 230lbs, initially the fit was fantastic and looks amazing but after wearing it and moving around in it for about 30 minutes, the pants started to slip down. The fabric has quite a bit of spandex in it and tends to stretch out after wearing for a little bit, it fits great right after it has been dried but then stretches out again. I ended up taking in the waist a little bit so the pants stay up, a large would likely have been a better fit. But he always looks amazing when he wears it and gets lots of compliments on the fun pattern. Definitely worth it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2024
J
Verified Purchase
jayymerk
Natrona Heights, US
★★★★★ 5
Great suit!
Size: X-Large, Color: Navy With Blue
I was pleasantly surprised by the quality of this Mage Male dress suit. The material feels very soft with a velvet-like texture that makes the entire outfit pop without being over the top. This suit is perfect for prom, weddings, or any event where you want to elevate your look a bit. Sizing was accurate for me, so make sure you follow the size chart closely. I recommend picking up an inexpensive tape measure here on Amazon to double-check your measurements — it makes a difference. For the price, this suit is absolutely worth it and I’d buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
B
Verified Purchase
Brad Nuzum
Birmingham, US
★★★★★ 5
Top notch suit
Material quality was too notch well worth the money. The size was true to size in all areas. Very stylish suit and so many compliments on it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 16, 2025

recommand products