SKU: 12786581044

ST6/CD82 His Tag Protein, Human

Sale price$356.40 Regular price$396.00
Save 10%

Pay in installments of $99.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ST6/CD82 His Tag Protein, HumanProduct Specification Species Human Antigen ST6 CD82 Synonyms KAI1, SAR2, TSPAN27 Accession P27701 1 Amino Acid Sequence Gly111 Leu228, with C terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 30kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Antigen ST6/CD82
Synonyms KAI1, SAR2, TSPAN27
Accession P27701-1
Amino Acid Sequence

Gly111-Leu228, with C-terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Jin?Woo Lee,Yoo?Wook Kwon, Cheong?Whan Chae, Jae?Il Choi, Injoo Hwang,Ji?Yeon Yun, Jin?A Kang, Young?Eun Choi, Young Hyun Kim, Sang Eun Lee. KAI1(CD82) is a key molecule to control angiogenesis and switch angiogenic milieu to quiescent state. Lee et al. J Hematol Oncol (2021) 14:148 https://doi.org/10.1186/s13045-021-01147-6.

Background

KAI1/CD82, a transmembrane protein and a member of the tetraspanin superfamily, is an evolutionally conserved molecule expressed in various tissue types. First identified to be involved in the T cell activation process, KAI1 is typically considered as a suppressor of metastasis. Most studies of KAI1 examined its function in suppressing metastasis and angiogenesis mainly in cancer cells and endothelial cells. Recently, we and others have reported that KAI1 regulates the cell cycle progression of the long-term repopulating hematopoietic stem cells (LT-HSCs) and muscle stem-progenitor cells. Thus, KAI1 has different roles in each cell and organ type.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12786581044

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
PikaJoon
Waukegan, US
★★★★★ 5
Haru LOVES this toy!
I recently purchased the Amazon Basics Hide and Seek Squeaky Dog Plush Toy, Rabbit and Carrot 5 Pack, and it has been an absolute hit with my dog Haru! This set has quickly become his favorite playtime activity, and it's easy to see why. From the moment I introduced Haru to the plush toys, he was hooked! The rabbit and carrot design is not only adorable but also adds an element of excitement and curiosity for him. The toys' quality is impressive, with sturdy stitching that has held up well to Haru's enthusiastic play style. The "hide and seek" aspect of the toys is brilliant. Each plush toy contains squeakers, which immediately captured Haru's attention. He thoroughly enjoys searching for the source of the squeaky sound and then triumphantly "catching" the rabbit or carrot. It's like a mini-game that keeps him mentally stimulated and entertained. One of the best things about this 5-pack set is the variety it offers. Haru never gets bored because he can alternate between the different plush toys, and each one presents a new challenge for him. Whether he's "hunting" the rabbit or "nibbling" on the carrot, his excitement is contagious! Furthermore, I appreciate how these toys keep Haru engaged for a good amount of time. As a busy dog owner, it's essential to have toys that can entertain him while I'm occupied with other tasks. The Hide and Seek Squeaky Dog Plush Toy accomplishes this perfectly, giving me some peace of mind knowing Haru is happily occupied.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2023
J
Verified Purchase
Jillian
Cuba, US
★★★★★ 5
Great toy
Great size for a medium to large dog and a good value overall. The carrot foliage is made of felt and can tear easily, but the carrot body and bunnies have typical toy durability. The bunnies include squeakers that are softer and not high-pitched. The holes are sized well—small enough that the bunnies don’t fall out on their own. Even with only a few stuffed inside, they stay put until your dog pulls them out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025
W
Verified Purchase
W. Willard
Carnegie, US
★★★★★ 5
I was shocked by how much my daughter's puppy enjoyed this toy!
I've bought two of these — one for my grand puppy to use when she's at my house, and another for her to keep at her house. I was shocked that she actually seems to enjoy playing with this toy! She hunts out all the bunnies and then brings the carrot to me to refill. I refill it, and then she takes the refilled carrot back to her spot and hunts them all out again. If I can't find one of the bunnies (because it's gotten stuck in the couch cushion, for example), I ask her "where's the bunny?" and she helps me find it! This dog is a ferocious chewer but she doesn't chew these toys! It's like she instinctively knows they are for hunting, not chewing. As a result, they have lasted a long time and provide hours of quality fun. Great value!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
W
Verified Purchase
WhiteheadsArt
Fort Morgan, US
★★★★★ 5
My Iggies LOVE this toy. Buy it!!!!!
As a new dog mom to Italian greyhounds, I wasn’t sure if they’d like this, but it is their favorite toy!!!! They LOVE playing with the rabbits, chewing on them, squishing them, flinging them and chasing them. My one iggy likes to chew on the carrot and stick her nose in it when it’s empty. I find the rabbits around the house. So cute and seems to be well made. Definitely worth the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 5
Very cute and well loved dog toy.
I have two maltese rescue dogs. One if still a puppy and the other is almost 5 years old. The youngest one is a chewer and goes through toys removing whatever she can as soon as she can. This is a VERY cute toy and comes with the 4 cute bunnies inside. My older dog loves to take the bunnies and cuddle them in her bed. So far the chewer has not been able to take them apart and for that I am very pleased. Very well made, stiched well. I was reluctant at first to purchase because of price, but I believe this is good value for your money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 1, 2026

recommand products