SKU: 3501838558

FABP3 His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP3 His Tag Protein, HumanProduct Specification Species Human Accession P05413 Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Expression System E. coli Molecular Weight 15. 7 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P05413
Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Expression System E.coli
Molecular Weight 15.7 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3501838558

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Whatcom Rider
Dallas, US
★★★★★ 5
These are real nice looking industrial look, but bear in mind, they don't come with the shelves
First, understand that you only get the structure, not the actual shelves. The structure is decorative, industrial. piping, which looks really cool., especially in my utility room. I'm gonna get some hardwood for the shelving, so I don't have a picture yet, but I will as soon as I get that. The frame is very stable and strong. So thumbs up on the stability, structure and quality. The directions are straightforward, and all the parts are there. It looks real nice in my utility room and will look real cool when I've got the shelving on there. It's definitely a good value for your money if you need more storage shelving.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
T
Teresa
Chelsea, US
★★★★★ 5
Perfect companion to other HBLYJS bracket systems — great aesthetic, versatility and functionality
I’m already a fan of the HBLYJS wall bracket system that I used in my daughter’s room, so I wanted to try this floor-to-ceiling option from the same brand for a slightly different look. The two coordinate perfectly — same black iron finish, same industrial-farmhouse aesthetic — and provided nice cohesion. What makes this system stand out is the flexibility in how you mount it. You can rest the uprights on the floor or hang them from the ceiling depending on your space and what works best structurally. That's a rare option and makes it easy to fit into rooms where a standard wall-mount wouldn't work as cleanly. I chose to hang them from the ceiling, because I personally love that look. Just make sure you mount these into studs! Like the bracket set, planks aren't included, but picking your own wood lets you match stain color and cut boards to the exact length you need. The heavy-duty pipe construction feels solid and the vertical design makes great use of wall space without eating into floor space. I definitely recommend the HBLYJS wall bracket systems for the great aesthetic, storage, versatility and functionality they provide. I will likely be buying a few more sets soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
G
George W.
Draper, US
★★★★★ 4
HBLYJS Industrial Pipe Shelving System
This shelving system gave my room a cool industrial look. The metal brackets feel heavy-duty and very stable. Installation took a little time but wasn’t difficult. I like that I can choose my own wood planks for customization. It holds a good amount of weight without sagging. The black iron finish looks great against the wall. This was a solid DIY upgrade for my space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
R
Rob Ross
Battle Creek, US
★★★★★ 5
Easy storage, good holding power
This industrial pipe shelving system is a very nice way to add DIY storage to any room. The parts come well protected and are easy to assemble. They come with all the hardware one needs to install, though I used my own wall anchors because I like the ones I use and I know they work very well. I also decided in the end not to use the support legs because they would have had the shelves too low when mounted from the ceiling. Instead, I took those off and flipped the frames over so nothing would get in there, and I'll probably get nipples and caps from the hardware store to finish off the bottoms. The frames are finished in black, and resemble old galvanized gas pipes. As previously mentioned, assembly is easy enough and they accommodate whatever width of shelf you want to put up, within a reasonable limit. I used 36" shelves because that's the space I had to work with. The fact that each flange has three screws, assuming this is installed correctly, it should be rock-solid. I know mine is. I installed this in our laundry room / craft room in order to get more storage space, because it is so very busy in there. Given one could purchase the parts needed to build one of these for less, it's still a good value for the money because then after you buy those parts you have to clean and paint them, as well as prepare the boards. All I had to do was assemble these, and then prepare the boards, which made my life easier and the time saved was well worth the little extra. They also look fantastic with natural-colored oiled pine. I recommend these racks for their aesthetic, ascetic appearance, and their ability to hold a good amount of weight and storage, and not to mention if they're installed like mine, they will hold rolled leather hides like nobody's business.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
J
JB
West Palm Beach, US
★★★★★ 5
Impressive
Format: Paperback
I’m really impressed with this book. It’s the perfect complement to the review course. It's been incredibly helpful in tying together complex concepts that are often difficult to master. I’ve already noticed a major improvement in my understanding and confidence. Highly recommend it for anyone preparing for advanced certification exams.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2025

recommand products