SKU: 71533741134

DNAM-1/CD226 His Tag Protein, Human

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DNAM-1/CD226 His Tag Protein, HumanProduct Specification Species Human Accession Q15762 Amino Acid Sequence Glu19 Asn247, with C terminal 8*His EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNGGGSHHHHHHHH Expression System HEK293 Molecular Weight 44 57 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g

Product Specification


Species Human
Accession Q15762
Amino Acid Sequence Glu19-Asn247, with C-terminal 8*His EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 44-57 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

DNAX accessory molecule 1 (DNAM-1; CD226) is a costimulatory molecule belonging to the immunoglobulin superfamily. DNAM-1 is primarily expressed on NK and CD8 T cells, which has been shown to enhance the cytotoxic effector function of NK cells and T cells against tumor- and virus-infected cells. DNAM-1 is a member of the Ig superfamily, encoded by a gene on human chromosome 18q22.3, is expressed by human NK cells, T cells, a subset of B cells, monocytes and platelets. Interactions between DNAM-1 on NK cells and its ligands on tumour cells augments the NK cell–mediated cytotoxicity and cytokine production. CD155 and its related family member CD112, the known ligands for DNAM-1, broadly expressed on hematopoietic, epithelial, and endothelial cells. Moreover, it was shown that the interaction of DNAM-1 with CD112 and CD155 contributes to the NK-mediated lysis of both imDCs and mDCs. NK cells also express CD96, which shows only ~20% homology to DNAM-1 but was also shown to recongnize CD155 and promote NK cell adhesion and activation. Decreased NK cell activity has been observed in patients with PDAC, and pancreatic cancer patients have less CD226+ NK cells in the blood than do healthy controls. Dysregulation of DNAM-1 is associated with susceptibility to juvenile idiopathic arthritis, type 1 diabetes (T1D), lupus, and rheumatoid arthritis in patients.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71533741134

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mary M.
Lowell, US
★★★★★ 4
It is a great wedge pillow, but takes time to get used to sleeping on your back
Color: Dark Grey & White, Size: Adjustable 9&12 Inch + 1 Head Pillow
I bought this for post-surgery, I had to sleep on my back. Nearly impossible as a lifelong side sleeper. It is memory foam, and it does seem to run hot. But after a couple of weeks, I'm adjusting to it. Back sleeping is best for saving your face from AM wrinkles and mascara smears all over pillows. (Yes I know, I should take off mascara before bed, but....). Now that I've adjusted to sleeping with it, it stays on my bed and I wake up without the creases on my face and neck! So if you are buying pre-surgery, buy in advance to adjust to a new style of sleeping! I'm keeping it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025
A
Verified Purchase
Allison
Boise, US
★★★★★ 5
Its worth the purchase!
Color: Black, Size: Adjustable 9&12 Inch + 1 Head Pillow
Bought this pillow because Im dealing with both GERD and neck pain so I decided to order this and hope for the best thats being said Im so glad I did because its helped me a lot with both issues. Some extra comments: Its a little firm but not in a bad way and the head rest is comfy but I do wish I could bring it down lower.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
M
Verified Purchase
Mrs Collins (& occasionally Hubs)
Cuba, US
★★★★★ 3
Misleading: Pillow Itself Has Only TWO Configurations!! >:(
Color: Black, Size: Adjustable 9&12 Inch + 1 Head Pillow
I was sold on the 10-Option bit until I realized there are only 2 choices as far as flooping and flopping the pillow itself. It is 2 triangles, a large one and a small one. The large triangle IS THE SAME ANGLE ON EACH END. The small triangle IS ATTACHED TO THE CENTER OF THE LARGE TRIANGLE. That means no matter how you move the pillow itself, you're getting the EXACT SAME THING. Where YOU come in is where all these infinity "versatility" options are - whether you put it upright or whether you put it flat. That's it. All this I can read in bed! I can play on my laptop! I can watch TV! Yeah that's upright. Option 1. And all this I can put it under my legs! I can use it as a normal pillow as well! That's flat. Option 2. There is absolutely nothing special or different about this thing except the stupid pocket. Had they not made the triangle the same angles on the end, had they made a steep angle and a low angle and that center pillow detachable but still velcro - THEN there would have been more elevation options. But this, I was highly disappointed. It's like saying, My bed has 360 options! (because I can lay 360 different degrees around the bed) AND 360 MORE BECAUSE GUESS WHAT! I CAN LAY ON MY STOMACH 360 DIFFERENT DEGREES around the bed! Oh! And on my side 360 degree different ways! Wait I have a left and a right side - the OTHER side I can lay on it around the bed 360 different degrees as well! And sitting cross-legged on the bed 360 different degree directions as well! So. No. It's a firm memory foam pillow. You lay upright or lay down or you put it under your legs or on your lap. It changes 2 ways and you make it work 4 ways. That's it. Yes it smells but not too bad, not foul, just persistently. Like a light chemical smell but it didn't aggravate me (I get scent, etc. migraines). It self-inflated pretty fast. But as you can tell, I was not impressed with it in reality. :(
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
T
Verified Purchase
TM Conway
Fort Morgan, US
★★★★★ 5
Helps my coughing
4.8 stars. This helps keep me sleeping at a good angle to prevent night coughing. Also, it's great for relaxing and watching tv in bed. I find that it is Goldilocks level firm - just enough to be supportive but soft enough for comfort. I wish I'd gotten the roll pillow now :-( It's hard to make my bed look "made" with this on it - no matter what color I get. I keep it on the side & out if sight til I need it. I do like the material & thankfully it's removable for cleaning, but I can tell it's going to wear with a lot, so I do wish it were easier to find more covers for it so I could have one on while washing one. Overall, I like this a lot. The only thing negative is that I can see that it will "pill" & fuzz up in places with more use. I do use this every night. One warning: As with any products like this that are suctioned close for packaging - be VERY careful. I always hold one corner of the plastic to open a little vent before I cut more to remove the pillow and let it "fluff". It would be easy to snip some of the fabric...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2025
M
Verified Purchase
MS in AZ
Charlottesville, US
★★★★★ 5
Helped my husband get a good night's rest after surgery.
Color: Dark Grey & White, Size: Adjustable 9&12 Inch + 1 Head Pillow
We bought this after my husband's heart surgery, and the doctors wanted him to sleep in an elevated position for a few weeks. Before this, he was just stacking some pillows behind his neck, which did not get him a comfortable night's rest. His first night using this was a game changer for him. It was the first time he was able to sleep through the night. It was just the right height, and just the right level of soft/firm. Once he's done with it, I think I'll steal it from him and use it for reading in bed. The little neck rest was super helpful too. Thanks to whoever invented this, and sells it at such a reasonable price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026

recommand products