Pay in installments of $130.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag
Product Specification
| Species | Human |
| Synonyms | HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human |
| Amino Acid Sequence |
Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE |
| Expression System | E.coli |
| Molecular Weight | 45 kDa |
| Purity | ＞85% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Liquid |
| Storage Buffer | 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5 |
| Reconstitution | A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 6 reviews
Sort
Product Reviews
★★★★★ 4
Not worth the money.
Color: Blue goose - pineapple plush
Not indestructible. My puppy chewed through it in two days.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
★★★★★ 5
It's one of the only toys that we originally got for our pup that has lasted
Color: Blue goose - pineapple plush
We got a lab mix (we think with a Great Dane) on Labor Day weekend 2025. She has destroyed 100% of the toys we got her that weekend, with the exception of this duck. Yes, it is missing it's feet at this point (they got chewed off and torn sometime around Halloween), but the duck itself is still intact. She chews on the duck every day, it's one of her favorite toys, and it's seen some things. We've washed it a few times in the laundry machine, and it looks nice a clean every time we pull it out and let it dry. She's gnawed on it through losing puppy teeth and getting adult teeth, and she's is currently chewing away on her duck on her bed in the living room.
I understand others have reported really mixed reviews, but I'm so glad we got this duck and it's one of the only toys we've bought that I feel like was worth the price because it didn't get destroyed immediately. We plan on buying another one for Christmas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2025
★★★★★ 5
Honestly….
Color: Blue goose - pineapple plush, Color: Blue goose - pineapple plush
I hate to buy Giant or Tiny a toy only to find it in some corner ignored. Would this goose make a lifetime friend OR would it fly away to some unknown corner of the house?!?! I was thrilled that Giant wanted to open the box himself. As soon as I set it on the table for some pictures, Giant saw his chance and grabbed it. This happened again! Safe to say, our family gives this a FIVE!! This is great as it squeaks and crinkles. It is super soft cloth and states it can hold up to aggressive chewers. It is one foot long. The stitching all seems to be in place. They state it is "Upgraded Indestructible" as it is sturdier material. The last toy has lived up to that claim.
QUALITY: 5 out of 5
PROS: For us, it's the crinkle sound. I'm not sure why but they love that sound. Easy wash and go is great too!
CONS: I wish it was bigger than one foot but that is because I have a big dog.
Overall, Fantastic toy that is always with a dog. I will need to purchase more to have hidden away should it ever get lost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
★★★★★ 3
“Indestructible” not so much
Color: Blue goose - pineapple plush
Cute as can be, but the cloth-only tips on the wings and tail were immediately ripped off, eaten, and vomited. I’m hoping without those, the toy will be “more” indestructible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
★★★★★ 4
He loved the toy
Color: Blue goose - pineapple plush, Color: Blue goose - pineapple plush
My dog loved this toy, however it is not indestructible, he had it in 2 pieces within a day, but I do need to say he is a big boy and we haven’t found a toy yet that he can’t destroy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
recommand products
NEW Cisco NIM-1T ISR 4000 Series 1x Serial WAN Router Interface Card
219.00
Molex 10110818-2010LF 1m 10GB SFP+ Direct Attach Copper Cable
12.99
Finisar FTLF8529P3BNV-E5 16GB Fibre Channel 850nm SW SFP Transceiver
12.99
Fortinet FG-500D FortiGate 500D 16 Gbps Local Management Only Firewall
129.99
NEW Cisco N55-PAC-1100W 1100W AC Back-to-Front Airflow (PSE) Power Supply
59.99