Pay in installments of $52.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD30/TNFRSF8 Fc Chimera Protein, HumanProduct Specification Species Human Accession P28908 Amino Acid Sequence Phe19 Lys379, with C terminal Human IgG Fc
Product Specification
| Species | Human |
| Accession | P28908 |
| Amino Acid Sequence | Phe19-Lys379, with C-terminal Human IgG Fc FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 95-120kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
CD30, a 120 kDa cytokine receptor and transmem-brane glycoprotein, is a member of the tumor necrosis factor (TNF) receptor superfamily. The protein is comprised of an extracellular domain, a transmembrane region and a cytoplasmic domain. The majority of antibodies against human CD30 recognize epitopes within the extracellular domain. The soluble form of CD30 has a molecular weight (85 kDa) produced through proteolytic cleavage releasing the extracellular domain. Binding of CD30 with its receptor ligand activates TNF receptor-associated factor (TRAF)2 and TRAF5, initiating signal transduction pathways that can lead either to proliferation or apoptosis; CD30 induced apoptosis may lead to the self-regression seen in lymphomatoid papulosis lesions, whereas proliferation may result in anaplastic large-cell lymphoma (ALCL). The expression of CD30 by malignant lymphocytes affords an opportunity as a therapeutic target. Because CD30 is not found in most normal tissues outside of the immune system or on resting monocytes or lymphocytes, it provides an ideal target for immunotherapy. While it has been demonstrated that anti-CD30 antibodies alone display therapeutic efficacy, newer agents markedly enhance antibody effectiveness through their conjugation with various cytotoxic agents. Therefore, CD30 can serve both as a diagnostic marker for lymphocyte malignancies and as a target for therapy.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy