SKU: 35152705855

Human Geminin , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Geminin , His tagProduct Specification Species Human Synonyms GMNN Accession O75496 Amino Acid Sequence Protein sequence(O75496, Leu110 Ile209, with C 10*His) MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 13. 1kDa Actual: 19kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized

Product Specification


Species Human
Synonyms GMNN
Accession O75496
Amino Acid Sequence

Protein sequence(O75496, Leu110-Ile209, with C-10*His)
MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:13.1kDa Actual:19kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Geminin is a nuclear protein present in most eukaryotes and highly conserved across species, numerous functions have been elucidated for geminin including roles in metazoan cell cycle, cellular proliferation, cell lineage commitment, and neural differentiation. One example of its function is the inhibition of Cdt1. Geminin has been found to be overexpressed in several malignancies and cancer cell lines, while there is data demonstrating that geminin acts as a tumor suppressor by safeguarding genome stability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35152705855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Charlie P
Carnegie, US
★★★★★ 4
Comfortable and good value
Color: Black, Size: XX-Large
The material of this cotton/linen blend kaftan is light and breathable. The sleeves are just the right length for me. The fit around my chest is a bit tight, but still it’s comfortable to wear so long as I don’t reach up for something. FYI, I have a 52-inch chest and ordered a size XXL (the largest available); this should allow others to judge how the size runs. I wore it to dinner with some Moroccan co-workers who dressed in similar garments; they were impressed, and complimented on how nice it looked on me. I told them that one day I’d surprise them with such a garment, and I definitely did just that. The lower 2 buttons work great, but the one around the collar has a very tight loop which makes it difficult to button and unbutton. I can’t use that button anyway because the collar is too small for my neck. The craftsmanship is top notch according to my friends. I didn’t mention that I got this for free, and let them know the Amazon price. They agreed with me that this was a good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
M
Verified Purchase
Mr. SUCCESSFUL CEO
Grantham, US
★★★★★ 5
Throbe
Color: Black, Size: X-Large
Good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
W
"WE WINN!!!"
Natrona Heights, US
★★★★★ 5
For the L*ve of the Game...
Color: Black, Size: XX-Large, Color: Black, Size: XX-Large
When I ordered this beautiful Thobe I noticed along with its minimalistic nature in looks that it took on, was the low price point... these dress garments usually run me a pretty penny in pastimes. It is soft, breathable & comfortable with a slender-like fit, all while being made of cotton and linen, which can be worn in multiple seasons... I ordered the black for a test run, and I am always on the look-out for (linen-cotton) around the clock (seasons)! And I am very pleased to report that I need additional colors because the quality of this garment is off the hook... and I want them all on MY hook! "WE WINN"
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
V
VSVS
Boise, US
★★★★★ 5
Fits great and works well in the hot summers - May order more in the future in other colors
Color: White, Size: X-Large
Looks and feels great - very breathable in the hot summers with the Cotton and Linen blend. It felt a little rough at first but after washing it it feels wonderful (and it did not shrink!). It fit well and the size is true to what the table shows. It felt a little long at first but I got used to it very quickly. It's comfortable when going outside when it's 80+ F outside. This seems like a quality product and I hope it will last for years to come. Within the next few months of summer, if I really like after wearing it a few times I might order some other colors!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
A
Verified Purchase
AP Thorne
Cuba, US
★★★★★ 5
Do not hesitate! This suit rocks
Used for a photo shoot and it looked Great! Very impressive quality for the price. Cut on the slim side and looks a bit retro
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026

recommand products