Pay in installments of $46.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 29 - Aug 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Lambda , His tagProduct Specification Species Human Synonyms Ig lambda chain C region MGC, Ig lambda 1 chain C region, IGLC1 Accession P0CG04 Amino Acid Sequence Protein sequence(P0CG04, Gly1 Ser106, with C 10*His) GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 13. 0kDa Actual: 16. 0kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag
Product Specification
| Species | Human |
| Synonyms | Ig lambda chain C region MGC, Ig lambda-1 chain C region, IGLC1 |
| Accession | P0CG04 |
| Amino Acid Sequence | Protein sequence(P0CG04, Gly1-Ser106, with C-10*His) GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH |
| Expression System | CHO |
| Molecular Weight | Theoretical:13.0kDa Actual:16.0kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
The immunoglobulin light chain is the small polypeptide subunit of an antibody (immunoglobulin). There are two types of light chain in humans: kappa (κ) chain and lambda (λ) chain. Individual B-cells in lymphoid tissue possess either kappa or lambda light chains, but never both together. Specific rearrangement of lambda light chain of immunoglobulins can lead to loss of some protein coding genes. Using immunohistochemistry, it is possible to determine the relative abundance of B-cells expressing kappa and lambda light chains. If the lymph node or similar tissue is reactive, or otherwise benign, it should possess a mixture of kappa positive and lambda positive cells. If, however, one type of light chain is significantly more common than the other, the cells are likely all derived from a small clonal population, which may indicate a malignant condition, such as B-cell lymphoma.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy