SKU: 63051738003

Human CD14, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD14, His tagProduct Specification Species Human Synonyms Myeloid cell specific leucine rich glycoprotein Accession P08571 Amino Acid Sequence Protein sequence(P08571, Thr20 Met344, with C 10*His)

Product Specification


Species Human
Synonyms Myeloid cell-specific leucine-rich glycoprotein
Accession P08571
Amino Acid Sequence Protein sequence(P08571, Thr20-Met344, with C-10*His) TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:36.7kDa Actual:50-55kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD14 (cluster of differentiation 14) is a human protein made mostly by macrophages as part of the innate immune system. It helps to detect bacteria in the body by binding lipopolysaccharide (LPS), a pathogen-associated molecular pattern (PAMP). CD14 acts as a co-receptor (along with the Toll-like receptor TLR 4 and MD-2) for the detection of bacterial lipopolysaccharide (LPS). CD14 can bind LPS only in the presence of lipopolysaccharide-binding protein (LBP). Although LPS is considered its main ligand, CD14 also recognizes other pathogen-associated molecular patterns such as lipoteichoic acid.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 63051738003

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jay
Chelsea, US
★★★★★ 2
Color was off. More plum than burgundy
Color: Burgundy, Size: 36W x 32L
The color was more plum than burgundy. I returned them. Not a plum pants kind of guy. I have gotten other colors. I actually love the fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
J
Verified Purchase
JacAk
Boise, US
★★★★★ 1
Do not trust sizing or measuents
Color: Black, Size: 32W x 30L
Sizing way off. Can barely fit on and no where close to buttoning. Same pant measurements in another pant bought at the same time no problem. Sizing and measurements off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
J
Verified Purchase
jimmydc
Lexington, US
★★★★★ 5
Nice
Size: 40W x 32L, Color: Beige
Very nice. Real quality. Would definitely purchase again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
B
Biggie
Draper, US
★★★★★ 5
real leather, comfortable, size up 1/2 size to avoid the breaking in process, its beautifully made!
Size: 10.5, Color: Medium Natural Nubuck
They fit perfectly. They are the best pair of shoes My husband's ever wore! the smell of that new leather is incredible. It is real leather, not imitation leather. It's a little tight across the top portion of his foot right before his toes start, but I believe that can be stretched out, they just have to be broken in. they are so classy and snazzy. The front of the toe part is a little darker than the rest. But it Kind of blends in fades into the rest of the leather. It will scratch easily. So you have to be careful, it's real leather. It's soft but not like felt soft and its shiny. This is the kind of shoe you actually need The old school shoe Polish in a buffer cloth. I didn't think that we would like or he would like the white soul but it does not look bad like I thought it would be. It does not stand out. It blends right in perfectly with the shoe. Any of their color would have not matched. If you're on the fence about this nice dress, you don't be. this name Shoe actually lives up to its reputation. It was incredible and no, I'm not just saying that. if it sucked, I would say so. it's a great shoe in every way. It has a cushioned soft leather insole. It's a little thinner piece of velour feeling leather In the instep. It is such a great shoe definitely worth the purchase. The size does fit. He wears a 10 and a 1/2. That's what we got, and that fits perfectly. I think he could have gotten 11 and got away with it, so he wouldn't have to break the top portion in. But there's plenty of toe room, it's just where your outer edge of your foot an the bone, right before your big toe, so like I said, right across the widest portion of your foot needs to be stretched out broken in. once he breaks that in the shoe fits perfectly. so you can size up half a size you probably can get away with it, just fine God bless!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
B
Beagleboy
Cuba, US
★★★★★ 5
High quality comfortable shoes from Rockport
Size: 13 Wide, Color: Grey Nubuck, Size: 13 Wide, Color: Grey Nubuck
I've been a fan of Rockport shoes since buying my first pair in the 1980's. I actually still have that pair and had them resoled once. This shoe has the style and profile of a dress shoe but is finished in a nice smooth suede-like grey color. Typical of Rockport shoes, they are flexible and lightweight. The upper is genuine leather, something getting harder to find in reasonably priced quality shoes. That should make these more durable than artificial leather. The insole is sculpted and soft with just a bit of memory foam padding with good arch support. They are removable and I assume replaceable. The soles are flexible and grippy, and the heel is low and comfortable. I ordered my usual size, 13W and they fit well, just a tiny bit tight on the top where they lace if wearing thick socks until they stretch a bit. Due to the shape of the toe box they look a little long, but there is plenty of toe space. These were very comfortable, true to size, well made and very nice looking shoes. I expect them to be durable and last a long time as all of my other Rockport shoes have in the past. These would look great with jeans or khaki's or even with more dressy clothing, they can be casual or dressy. Even though these are well made and genuine leather with Rockport's reputation for comfort and quality they cost less than many sneakers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products